PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G122400.1
Common NamePHAVU_007G122400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 964aa    MW: 108788 Da    PI: 5.4407
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G122400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.6e-14853248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Phvul.007G122400.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                        78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  Phvul.007G122400.1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                         68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.3E-131070No hitNo description
CDDcd001675.79E-121053No hitNo description
SuperFamilySSF466897.19E-2133106IPR009057Homeodomain-like
CDDcd116598.46E-3155106No hitNo description
Gene3DG3DSA:1.10.10.603.0E-1457104IPR009057Homeodomain-like
SMARTSM007176.7E-1358105IPR001005SANT/Myb domain
PROSITE profilePS5129416.92158107IPR017930Myb domain
PfamPF118312.5E-57406653IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 964 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDTACVKD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TKGKKAKRKA REKQLEEARR  180
LASLQKKREL KAAGIDIRKR KRKRKGIDYN AEIPFEKRPP SGFFDVTDED RPVEQPKFPT  240
TIEELEGKRR VDIEAQLRKQ DIAKNKIAER QDAPSAILHA NKLNDPETVR KRSKLMLPPP  300
QISDQELDEI AKLSYAGDLI GSQELAEGNS ATRALLANYA QTPGHGATPL RTPQRTPAGK  360
GDAIMMEAEN LARLRESQTP LLGGENPELH PSDFSGVTPK IKDIQTPNPM LTPSATPGGA  420
GLTPRIGVTP SRDGSFSMTP KGITLRDELH INEDRNMLDS SKLELHRQAD MRRSLQYGLG  480
SLPQPKNEYQ IVMEPVQEDT EEPEEKIEED MSDRIAREKK EEEARQQALL RKRSKVLQRE  540
LPRPPAASLE LIRNSLMRID GDKSSFVPPT SIEQADEMIR RELLTLLEHD NAKYPFDDKV  600
NKEKKKGVKR AANGSAVPVI EDFQEDEMKD ADKLIKEEAQ YVCAAMGHEN EPLDEFIEAH  660
RTCLNDLMYF PTRNAYGLSS VAGNMEKLAA LQNEFENLRN KLDDGNEKMV RFEKKVLVLT  720
QGYEMRVKKS LWPQIEATFK QMDIAATELE CFKALQKQEQ LAASHRIHNL WAEVQKQKEL  780
EKTLQNRYGS LIKELEKVQN IMDRCRLQAQ EIEANNHALE STEITETTHK TDVQGTENRE  840
VVPHSEENGN ALARDGTADQ QVDIVQDQAT SSPSYDMDVD SHKMQTIHDT DVKFTNASPA  900
AGNVAQKMDG TSTTEGNADN GEAMPEMGGI VETSSLNHGV FADAVNPRDS SLEESNAVGE  960
ETN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KKRELKAAGIDIRKRKRKRK
2198204KRKRKRK
3199204RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144020.10.0hypothetical protein PHAVU_007G122400g
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLV7BDU90.0V7BDU9_PHAVU; Uncharacterized protein
STRINGGLYMA10G30870.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5